Lineage for d1kfai1 (1kfa I:3-121)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353030Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (15 PDB entries)
    Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity
  8. 2353049Domain d1kfai1: 1kfa I:3-121 [77363]
    Other proteins in same PDB: d1kfah2, d1kfai2, d1kfal1, d1kfal2, d1kfam1, d1kfam2
    part of anti-gibberellin A4 Fab 4-B8(8)/E9; conflict: annotated in PDB as human protein
    complexed with ga4

Details for d1kfai1

PDB Entry: 1kfa (more details), 2.8 Å

PDB Description: Crystal structure of Fab fragment complexed with gibberellin A4
PDB Compounds: (I:) monoclonal antibody heavy chain

SCOPe Domain Sequences for d1kfai1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfai1 b.1.1.1 (I:3-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
mlvesggglvkpggslklscaasgftfssyamswvrqtperrlewvatittrgytfypds
vkgrftvsrdnarntlnlqmsslrsedtamfyctregllldyftmdywgqgtsvtvss

SCOPe Domain Coordinates for d1kfai1:

Click to download the PDB-style file with coordinates for d1kfai1.
(The format of our PDB-style files is described here.)

Timeline for d1kfai1: