SCOP 1.63: Domain d1kfai1: 1kfa I:3-121

Lineage for d1kfai1 (1kfa I:3-121)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-gibberellin A4 Fab 4-B8(8)/E9, (human), kappa L chain [81946] (1 PDB entry)

8. Domain d1kfai1: 1kfa I:3-121 [77363]
   Other proteins in same PDB: d1kfah2, d1kfai2, d1kfal2, d1kfam2
   complexed with ga4

Details for d1kfai1

PDB Entry: 1kfa, 2.8 Å

PDB Description: Crystal structure of Fab fragment complexed with gibberellin A4

SCOP Domain Sequences for d1kfai1:

Sequence; same for both SEQRES and ATOM records:

>d1kfai1 b.1.1.1 (I:3-121) Immunoglobulin (variable domains of L and H chains) {Anti-gibberellin A4 Fab 4-B8(8)/E9, (human), kappa L chain}
mlvesggglvkpggslklscaasgftfssyamswvrqtperrlewvatittrgytfypds
vkgrftvsrdnarntlnlqmsslrsedtamfyctregllldyftmdywgqgtsvtvss

Timeline for d1kfai1:

• d1kfai1 is new in SCOP 1.63
  
• d1kfai1 appears in SCOP 1.65
  
• d1kfai1 appears in the current release, SCOPe 2.08