Lineage for d1kf9a_ (1kf9 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280090Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 280091Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglments of the two crossover connections
  5. 280092Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 280117Protein Growth hormone, somatotropin [47276] (1 species)
  7. 280118Species Human (Homo sapiens) [TaxId:9606] [47277] (9 PDB entries)
  8. 280124Domain d1kf9a_: 1kf9 A: [77351]
    Other proteins in same PDB: d1kf9b1, d1kf9b2, d1kf9c1, d1kf9c2, d1kf9e1, d1kf9e2, d1kf9f1, d1kf9f2

Details for d1kf9a_

PDB Entry: 1kf9 (more details), 2.6 Å

PDB Description: phage display derived variant of human growth hormone complexed with two copies of the extracellular domain of its receptor

SCOP Domain Sequences for d1kf9a_:

Sequence, based on SEQRES records: (download)

>d1kf9a_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens)}
fptiplsrladnawlradrlnqlafdtyqefeeayipkeqihsfwwnpqtslcpsesipt
psnkeetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeg
iqtlmgrledgsprtgqifkqtyskfdtnshnddallknygllycfnkdmskvstylrtv
qcrsvegscg

Sequence, based on observed residues (ATOM records): (download)

>d1kf9a_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens)}
fptiplsrladnawlradrlnqlafdtyqefeeayipkeqihsfwwnpqtslcpsesipt
psnkeetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeg
iqtlmgrlllknygllycfnkdmskvstylrtvqcrsscg

SCOP Domain Coordinates for d1kf9a_:

Click to download the PDB-style file with coordinates for d1kf9a_.
(The format of our PDB-style files is described here.)

Timeline for d1kf9a_: