Lineage for d1kegl1 (1keg L:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653172Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
  8. 653239Domain d1kegl1: 1keg L:1-107 [77347]
    Other proteins in same PDB: d1kegh1, d1kegh2, d1kegl2
    part of anti-photoproduct Fab 64M-2
    complexed with 64t, ni

Details for d1kegl1

PDB Entry: 1keg (more details), 2.4 Å

PDB Description: Antibody 64M-2 Fab complexed with dTT(6-4)TT
PDB Compounds: (L:) anti-(6-4) photoproduct antibody 64m-2 fab (light chain)

SCOP Domain Sequences for d1kegl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kegl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgslvptfgggtkleik

SCOP Domain Coordinates for d1kegl1:

Click to download the PDB-style file with coordinates for d1kegl1.
(The format of our PDB-style files is described here.)

Timeline for d1kegl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kegl2