SCOPe 2.03: Domain d1kbym_: 1kby M:

Lineage for d1kbym_ (1kby M:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (55 PDB entries)
   Uniprot P02953

8. Domain d1kbym_: 1kby M: [77330]
   Other proteins in same PDB: d1kbyh1, d1kbyh2, d1kbyl_
   complexed with bcl, bph, cdl, cl, fe, spo, u10

Details for d1kbym_

PDB Entry: 1kby, 2.5 Å

PDB Description: structure of photosynthetic reaction center with bacteriochlorophyll- bacteriopheophytin heterodimer

PDB Compounds: (M:) Photosynthetic Reaction center protein M chain

SCOPe Domain Sequences for d1kbym_:

Sequence; same for both SEQRES and ATOM records:

>d1kbym_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpflglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1kbym_:

• d1kbym_ first appeared in SCOP 1.63
  
• d1kbym_ appears in SCOPe 2.02
  
• d1kbym_ appears in SCOPe 2.04
  
• d1kbym_ appears in the current release, SCOPe 2.08