Lineage for d1kbym_ (1kby M:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268375Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 268376Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 268377Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 268426Protein M (medium) subunit [81481] (3 species)
  7. 268427Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)
  8. 268434Domain d1kbym_: 1kby M: [77330]
    Other proteins in same PDB: d1kbyh1, d1kbyh2, d1kbyl_
    complexed with bcl, bph, cdl, cl, fe, spo, u10; mutant

Details for d1kbym_

PDB Entry: 1kby (more details), 2.5 Å

PDB Description: structure of photosynthetic reaction center with bacteriochlorophyll- bacteriopheophytin heterodimer

SCOP Domain Sequences for d1kbym_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbym_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpflglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOP Domain Coordinates for d1kbym_:

Click to download the PDB-style file with coordinates for d1kbym_.
(The format of our PDB-style files is described here.)

Timeline for d1kbym_: