![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
![]() | Species Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain [63641] (3 PDB entries) |
![]() | Domain d1kb9k_: 1kb9 K: [77326] Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_ complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6 |
PDB Entry: 1kb9 (more details), 2.3 Å
SCOP Domain Sequences for d1kb9k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb9k_ b.1.1.1 (K:) Immunoglobulin (variable domains of L and H chains) {Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain} dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik
Timeline for d1kb9k_: