Lineage for d1kb9j_ (1kb9 J:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219988Species Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain [63641] (3 PDB entries)
  8. 219991Domain d1kb9j_: 1kb9 J: [77325]
    Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_

Details for d1kb9j_

PDB Entry: 1kb9 (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex

SCOP Domain Sequences for d1kb9j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb9j_ b.1.1.1 (J:) Immunoglobulin (variable domains of L and H chains) {Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain}
evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
ssawrhp

SCOP Domain Coordinates for d1kb9j_:

Click to download the PDB-style file with coordinates for d1kb9j_.
(The format of our PDB-style files is described here.)

Timeline for d1kb9j_: