Details for d1kb9i_

PDB Entry: 1kb9 (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex
PDB Compounds: (I:)

SCOP Domain Sequences for d1kb9i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb9i_ f.23.14.1 (I:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae)}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOP Domain Coordinates for d1kb9i_:

Click to download the PDB-style file with coordinates for d1kb9i_.
(The format of our PDB-style files is described here.)

Timeline for d1kb9i_: