![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
![]() | Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() |
![]() | Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein) |
![]() | Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (4 PDB entries) |
![]() | Domain d1kb9h_: 1kb9 H: [77323] Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9i_, d1kb9j_, d1kb9k_ |
PDB Entry: 1kb9 (more details), 2.3 Å
SCOP Domain Sequences for d1kb9h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb9h_ f.23.13.1 (H:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae)} gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli pagiywywwkngneyneflyskagreelervnv
Timeline for d1kb9h_: