Lineage for d1kb9g_ (1kb9 G:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426780Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 426781Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
  5. 426782Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 426783Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 426784Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81521] (4 PDB entries)
  8. 426786Domain d1kb9g_: 1kb9 G: [77322]
    Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_
    complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6

Details for d1kb9g_

PDB Entry: 1kb9 (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex

SCOP Domain Sequences for d1kb9g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb9g_ f.27.1.1 (G:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae)}
qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
ievsk

SCOP Domain Coordinates for d1kb9g_:

Click to download the PDB-style file with coordinates for d1kb9g_.
(The format of our PDB-style files is described here.)

Timeline for d1kb9g_: