Lineage for d1kb9d2 (1kb9 D:261-307)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268041Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 268205Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) (S)
  5. 268206Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)
  6. 268207Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)
  7. 268208Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81493] (3 PDB entries)
  8. 268210Domain d1kb9d2: 1kb9 D:261-307 [77318]
    Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_
    complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6

Details for d1kb9d2

PDB Entry: 1kb9 (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex

SCOP Domain Sequences for d1kb9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb9d2 f.23.11.1 (D:261-307) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae)}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkp

SCOP Domain Coordinates for d1kb9d2:

Click to download the PDB-style file with coordinates for d1kb9d2.
(The format of our PDB-style files is described here.)

Timeline for d1kb9d2: