Lineage for d1kb9d1 (1kb9 D:62-260)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1720126Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 1720127Protein Cytochrome bc1 domain [46677] (3 species)
  7. 1720128Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63462] (7 PDB entries)
  8. 1720131Domain d1kb9d1: 1kb9 D:62-260 [77317]
    Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_
    complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6

Details for d1kb9d1

PDB Entry: 1kb9 (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex
PDB Compounds: (D:) cytochrome c1, heme protein

SCOPe Domain Sequences for d1kb9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb9d1 a.3.1.3 (D:62-260) Cytochrome bc1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
attsqmakdvttflnwcae

SCOPe Domain Coordinates for d1kb9d1:

Click to download the PDB-style file with coordinates for d1kb9d1.
(The format of our PDB-style files is described here.)

Timeline for d1kb9d1: