SCOP 1.73: Domain d1kb9d1: 1kb9 D:62-260

Lineage for d1kb9d1 (1kb9 D:62-260)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)

6. Protein Cytochrome bc1 domain [46677] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63462] (5 PDB entries)

8. Domain d1kb9d1: 1kb9 D:62-260 [77317]
   Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9c2, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_
   complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6

Details for d1kb9d1

PDB Entry: 1kb9, 2.3 Å

PDB Description: yeast cytochrome bc1 complex

PDB Compounds: (D:) cytochrome c1, heme protein

SCOP Domain Sequences for d1kb9d1:

Sequence; same for both SEQRES and ATOM records:

>d1kb9d1 a.3.1.3 (D:62-260) Cytochrome bc1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
attsqmakdvttflnwcae

Timeline for d1kb9d1:

• d1kb9d1 first appeared in SCOP 1.63
  
• d1kb9d1 appears in SCOP 1.71
  
• d1kb9d1 appears in SCOP 1.75
  
• d1kb9d1 appears in the current release, SCOPe 2.08