Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81640] (5 PDB entries) |
Domain d1kb9c2: 1kb9 C:1-261 [77316] Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9b1, d1kb9b2, d1kb9c1, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_ complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6 |
PDB Entry: 1kb9 (more details), 2.3 Å
SCOP Domain Sequences for d1kb9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb9c2 f.21.1.2 (C:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii ftltiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil alfvfyspntlghpdnyipgn
Timeline for d1kb9c2: