SCOPe 2.03: Domain d1kb9b2: 1kb9 B:219-368

Lineage for d1kb9b2 (1kb9 B:219-368)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (7 PDB entries)

8. Domain d1kb9b2: 1kb9 B:219-368 [77314]
   Other proteins in same PDB: d1kb9a1, d1kb9a2, d1kb9c1, d1kb9c2, d1kb9d1, d1kb9d2, d1kb9e1, d1kb9e2, d1kb9f_, d1kb9g_, d1kb9h_, d1kb9i_, d1kb9j_, d1kb9k_
   complexed with cdl, fes, hem, pcf, pef, pie, sma, umq, uq6

Details for d1kb9b2

PDB Entry: 1kb9, 2.3 Å

PDB Description: yeast cytochrome bc1 complex

PDB Compounds: (B:) ubiquinol-cytochrome c reductase complex core protein 2

SCOPe Domain Sequences for d1kb9b2:

Sequence; same for both SEQRES and ATOM records:

>d1kb9b2 d.185.1.1 (B:219-368) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sepkfflgeenrvrfigdsvaaigipvnkaslaqyevlanyltsalselsglissakldk
ftdgglftlfvrdqdsavvssnikkivadlkkgkdlspainytklknavqnesvsspiel
nfdavkdfklgkfnyvavgdvsnlpyldel

Timeline for d1kb9b2:

• d1kb9b2 first appeared in SCOP 1.63
  
• d1kb9b2 appears in SCOPe 2.02
  
• d1kb9b2 appears in SCOPe 2.04
  
• d1kb9b2 appears in the current release, SCOPe 2.08