SCOPe 2.06: Domain d1katw_: 1kat W:

Lineage for d1katw_ (1kat W:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (20 PDB entries)
   Uniprot P15692 40-133

8. Domain d1katw_: 1kat W: [77310]
   complexed with a phage-derived peptide antagonist, chains X and Y

Details for d1katw_

PDB Entry: 1kat

PDB Description: solution structure of a phage-derived peptide antagonist in complex with vascular endothelial growth factor

PDB Compounds: (W:) vascular endothelial growth factor

SCOPe Domain Sequences for d1katw_:

Sequence; same for both SEQRES and ATOM records:

>d1katw_ g.17.1.1 (W:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
teesnitmqimrikphqgqhigemsflqhnkcecrpkkd

Timeline for d1katw_:

• d1katw_ first appeared in SCOP 1.63
  
• d1katw_ appears in SCOPe 2.05
  
• d1katw_ appears in SCOPe 2.07
  
• d1katw_ appears in the current release, SCOPe 2.08