Lineage for d1katw_ (1kat W:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033578Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 3033590Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 3033593Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries)
    Uniprot P15692 40-133
  8. 3033643Domain d1katw_: 1kat W: [77310]
    complexed with a phage-derived peptide antagonist, chains X and Y

Details for d1katw_

PDB Entry: 1kat (more details)

PDB Description: solution structure of a phage-derived peptide antagonist in complex with vascular endothelial growth factor
PDB Compounds: (W:) vascular endothelial growth factor

SCOPe Domain Sequences for d1katw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1katw_ g.17.1.1 (W:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
teesnitmqimrikphqgqhigemsflqhnkcecrpkkd

SCOPe Domain Coordinates for d1katw_:

Click to download the PDB-style file with coordinates for d1katw_.
(The format of our PDB-style files is described here.)

Timeline for d1katw_: