Lineage for d1k9fa2 (1k9f A:4-142)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259924Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 260262Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 260278Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
    family GH67
  6. 260279Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
  7. 260280Species Bacillus stearothermophilus [TaxId:1422] [82740] (3 PDB entries)
  8. 260282Domain d1k9fa2: 1k9f A:4-142 [77297]
    Other proteins in same PDB: d1k9fa1
    complexed with gcv, gol, xyp; mutant

Details for d1k9fa2

PDB Entry: 1k9f (more details), 1.75 Å

PDB Description: crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with aldotetraouronic acid

SCOP Domain Sequences for d1k9fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9fa2 d.92.2.2 (A:4-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus}
gyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqevnet
ansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflr
llqmgeniaqlsiieqpkn

SCOP Domain Coordinates for d1k9fa2:

Click to download the PDB-style file with coordinates for d1k9fa2.
(The format of our PDB-style files is described here.)

Timeline for d1k9fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k9fa1