Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein) family GH67 |
Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [82740] (3 PDB entries) |
Domain d1k9fa2: 1k9f A:4-142 [77297] Other proteins in same PDB: d1k9fa1 complexed with gcv, gol, xyp; mutant |
PDB Entry: 1k9f (more details), 1.75 Å
SCOP Domain Sequences for d1k9fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k9fa2 d.92.2.2 (A:4-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus} gyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqevnet ansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflr llqmgeniaqlsiieqpkn
Timeline for d1k9fa2: