Lineage for d1k9fa2 (1k9f A:4-142)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2965096Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2965146Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
    family GH67
    automatically mapped to Pfam PF03648
  6. 2965147Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
    inverting reaction mechanism
  7. 2965148Species Bacillus stearothermophilus [TaxId:1422] [82740] (7 PDB entries)
  8. 2965153Domain d1k9fa2: 1k9f A:4-142 [77297]
    Other proteins in same PDB: d1k9fa1
    complexed with gol

Details for d1k9fa2

PDB Entry: 1k9f (more details), 1.75 Å

PDB Description: crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with aldotetraouronic acid
PDB Compounds: (A:) alpha-d-glucuronidase

SCOPe Domain Sequences for d1k9fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9fa2 d.92.2.2 (A:4-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
gyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqevnet
ansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflr
llqmgeniaqlsiieqpkn

SCOPe Domain Coordinates for d1k9fa2:

Click to download the PDB-style file with coordinates for d1k9fa2.
(The format of our PDB-style files is described here.)

Timeline for d1k9fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k9fa1