![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
![]() | Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
![]() | Species Erwinia chrysanthemi [TaxId:556] [82735] (7 PDB entries) Protease C |
![]() | Domain d1k7qa2: 1k7q A:18-258 [77284] Other proteins in same PDB: d1k7qa1 complexed with ca, zn; mutant |
PDB Entry: 1k7q (more details), 1.8 Å
SCOPe Domain Sequences for d1k7qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k7qa2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtfthaighalgla hpgeynagegdpsyndavyaedsyqfsimsywgenetgadynghyggapmiddiaaiqrl y
Timeline for d1k7qa2: