SCOPe 2.05: Domain d1k7ga2: 1k7g A:25-258

Lineage for d1k7ga2 (1k7g A:25-258)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
   characteristic HEXXHXXGXXH motif and Met located near C-terminus

6. Protein Metalloprotease [55509] (4 species)
   the rest of protein is all-beta sandwich containing a parallel beta-helix

7. Species Erwinia chrysanthemi [TaxId:556] [82735] (9 PDB entries)
   Protease C

8. Domain d1k7ga2: 1k7g A:25-258 [77280]
   Other proteins in same PDB: d1k7ga1
   complexed with ca, po4, zn

Details for d1k7ga2

PDB Entry: 1k7g, 2 Å

PDB Description: PrtC from Erwinia chrysanthemi

PDB Compounds: (A:) secreted protease C

SCOPe Domain Sequences for d1k7ga2:

Sequence; same for both SEQRES and ATOM records:

>d1k7ga2 d.92.1.6 (A:25-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
nsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanltfkflqsv
ssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnytrdasgnl
dygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalglahpgeyna
gegdpsyndavyaedsyqfsimsywgenetgadynghyggapmiddiaaiqrly

Timeline for d1k7ga2:

• d1k7ga2 first appeared in SCOP 1.63
  
• d1k7ga2 appears in SCOPe 2.04
  
• d1k7ga2 appears in SCOPe 2.06
  
• d1k7ga2 appears in the current release, SCOPe 2.08