Lineage for d1k7ga1 (1k7g A:259-479)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302882Fold b.79: beta-Roll [51119] (1 superfamily)
    contains a parallel beta-helix that binds calcium ions between its turns
  4. 302883Superfamily b.79.1: Serralysin-like metalloprotease, C-terminal domain [51120] (1 family) (S)
    duplication: halfturs of beta-helix are sequence and structural repeats
  5. 302884Family b.79.1.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
  6. 302885Protein Metalloprotease [51122] (4 species)
    The catalitic N-terminal domain belong to the "zincin" superfamily
  7. 302886Species Erwinia chrysanthemi [TaxId:556] [82189] (5 PDB entries)
    protease C
  8. 302890Domain d1k7ga1: 1k7g A:259-479 [77279]
    Other proteins in same PDB: d1k7ga2
    complexed with ca, po4, zn

Details for d1k7ga1

PDB Entry: 1k7g (more details), 2 Å

PDB Description: PrtC from Erwinia chrysanthemi

SCOP Domain Sequences for d1k7ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7ga1 b.79.1.1 (A:259-479) Metalloprotease {Erwinia chrysanthemi}
ganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinln
egsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagadt
lyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqe
vmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv

SCOP Domain Coordinates for d1k7ga1:

Click to download the PDB-style file with coordinates for d1k7ga1.
(The format of our PDB-style files is described here.)

Timeline for d1k7ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k7ga2