SCOP 1.71: Domain d1k3zb_: 1k3z B:

Lineage for d1k3zb_ (1k3z B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (6 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49254] (10 PDB entries)

8. Domain d1k3zb_: 1k3z B: [77250]
   Other proteins in same PDB: d1k3zd_
   mutant

Details for d1k3zb_

PDB Entry: 1k3z, 2.5 Å

PDB Description: x-ray crystal structure of the ikbb/nf-kb p65 homodimer complex

SCOP Domain Sequences for d1k3zb_:

Sequence; same for both SEQRES and ATOM records:

>d1k3zb_ b.1.18.1 (B:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus)}
taelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkrtyet

Timeline for d1k3zb_:

• d1k3zb_ first appeared in SCOP 1.63
  
• d1k3zb_ appears in SCOP 1.69
  
• d1k3zb_ appears in SCOP 1.73
  
• d1k3zb_ appears in the current release, SCOPe 2.08