Lineage for d1k3yb1 (1k3y B:81-222)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2712845Protein Class alpha GST [81349] (8 species)
  7. 2712858Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
    Uniprot P08263
  8. 2712864Domain d1k3yb1: 1k3y B:81-222 [77247]
    Other proteins in same PDB: d1k3ya2, d1k3yb2
    complexed with gol, gtx

Details for d1k3yb1

PDB Entry: 1k3y (more details), 1.3 Å

PDB Description: crystal structure analysis of human glutathione s-transferase with s- hexyl glutatione and glycerol at 1.3 angstrom
PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d1k3yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3yb1 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOPe Domain Coordinates for d1k3yb1:

Click to download the PDB-style file with coordinates for d1k3yb1.
(The format of our PDB-style files is described here.)

Timeline for d1k3yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k3yb2