Class a: All alpha proteins [46456] (202 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (2 proteins) contains 4 helices in the core |
Protein Endonuclease VIII [81703] (1 species) |
Species Escherichia coli [TaxId:562] [81704] (2 PDB entries) |
Domain d1k3xa1: 1k3x A:125-213 [77242] Other proteins in same PDB: d1k3xa2, d1k3xa3 complexed with bro, gol, ped, so4, zn |
PDB Entry: 1k3x (more details), 1.25 Å
SCOP Domain Sequences for d1k3xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3xa1 a.156.1.2 (A:125-213) Endonuclease VIII {Escherichia coli} vgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnh kakdlnaaqldalahalleiprfsyatrg
Timeline for d1k3xa1: