SCOP 1.73: Domain d1k3wa2: 1k3w A:1-124

Lineage for d1k3wa2 (1k3w A:1-124)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family)

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)

6. Protein Endonuclease VIII [82233] (1 species)

7. Species Escherichia coli [TaxId:562] [82234] (5 PDB entries)

8. Domain d1k3wa2: 1k3w A:1-124 [77240]
   Other proteins in same PDB: d1k3wa1, d1k3wa3
   complexed with ped, so4, zn

Details for d1k3wa2

PDB Entry: 1k3w, 1.42 Å

PDB Description: crystal structure of a trapped reaction intermediate of the dna repair enzyme endonuclease viii with dna

PDB Compounds: (A:) Endonuclease VIII

SCOP Domain Sequences for d1k3wa2:

Sequence; same for both SEQRES and ATOM records:

>d1k3wa2 b.113.1.1 (A:1-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
pegpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
flqr

Timeline for d1k3wa2:

• d1k3wa2 first appeared in SCOP 1.63
  
• d1k3wa2 appears in SCOP 1.71
  
• d1k3wa2 appears in SCOP 1.75
  
• d1k3wa2 appears in the current release, SCOPe 2.08