SCOPe 2.04: Domain d1k3oa1: 1k3o A:81-209

Lineage for d1k3oa1 (1k3o A:81-209)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (27 PDB entries)
   Uniprot P08263

8. Domain d1k3oa1: 1k3o A:81-209 [77233]
   Other proteins in same PDB: d1k3oa2, d1k3ob2

Details for d1k3oa1

PDB Entry: 1k3o, 1.8 Å

PDB Description: crystal structure analysis of apo glutathione s-transferase

PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d1k3oa1:

Sequence, based on SEQRES records:

>d1k3oa1 a.45.1.1 (A:81-209) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

Sequence, based on observed residues (ATOM records):

>d1k3oa1 a.45.1.1 (A:81-209) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllplalikekiknryfpafekvlkshgqdylvg
nklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqpgsprkppmd

Timeline for d1k3oa1:

• d1k3oa1 first appeared in SCOP 1.63
  
• d1k3oa1 appears in SCOPe 2.03
  
• d1k3oa1 appears in SCOPe 2.05
  
• d1k3oa1 appears in the current release, SCOPe 2.08