Lineage for d1k3oa1 (1k3o A:81-209)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281527Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 281528Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 281529Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 281538Protein Class alpha GST [81349] (8 species)
  7. 281548Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (10 PDB entries)
  8. 281555Domain d1k3oa1: 1k3o A:81-209 [77233]
    Other proteins in same PDB: d1k3oa2, d1k3ob2

Details for d1k3oa1

PDB Entry: 1k3o (more details), 1.8 Å

PDB Description: crystal structure analysis of apo glutathione s-transferase

SCOP Domain Sequences for d1k3oa1:

Sequence, based on SEQRES records: (download)

>d1k3oa1 a.45.1.1 (A:81-209) Class alpha GST {Human (Homo sapiens), (a1-1)}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmd

Sequence, based on observed residues (ATOM records): (download)

>d1k3oa1 a.45.1.1 (A:81-209) Class alpha GST {Human (Homo sapiens), (a1-1)}
lygkdikeralidmyiegiadlgemilllplalikekiknryfpafekvlkshgqdylvg
nklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqpgsprkppmd

SCOP Domain Coordinates for d1k3oa1:

Click to download the PDB-style file with coordinates for d1k3oa1.
(The format of our PDB-style files is described here.)

Timeline for d1k3oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k3oa2