Lineage for d1k1kb_ (1k1k B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 208554Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 208555Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 208567Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 208921Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 208970Species Human (Homo sapiens) [TaxId:9606] [46501] (95 PDB entries)
  8. 209077Domain d1k1kb_: 1k1k B: [77228]
    Other proteins in same PDB: d1k1ka_
    complexed with cmo, hem; mutant

Details for d1k1kb_

PDB Entry: 1k1k (more details), 2 Å

PDB Description: Structure of Mutant Human Carbonmonoxyhemoglobin C (beta E6K) at 2.0 Angstrom Resolution in Phosphate Buffer.

SCOP Domain Sequences for d1k1kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1kb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
vhltpkeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1k1kb_:

Click to download the PDB-style file with coordinates for d1k1kb_.
(The format of our PDB-style files is described here.)

Timeline for d1k1kb_: