Lineage for d1k19a_ (1k19 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 284904Superfamily a.118.1: ARM repeat [48371] (13 families) (S)
  5. 285056Family a.118.1.12: Chemosensory protein Csp2 [81898] (1 protein)
  6. 285057Protein Chemosensory protein Csp2 [81899] (1 species)
  7. 285058Species Cabbage moth (Mamestra brassicae) [TaxId:55057] [81900] (5 PDB entries)
  8. 285065Domain d1k19a_: 1k19 A: [77226]

Details for d1k19a_

PDB Entry: 1k19 (more details)

PDB Description: nmr solution structure of the chemosensory protein csp2 from moth mamestra brassicae

SCOP Domain Sequences for d1k19a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k19a_ a.118.1.12 (A:) Chemosensory protein Csp2 {Cabbage moth (Mamestra brassicae)}
edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
nqekgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipee

SCOP Domain Coordinates for d1k19a_:

Click to download the PDB-style file with coordinates for d1k19a_.
(The format of our PDB-style files is described here.)

Timeline for d1k19a_: