| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (3 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (7 proteins) |
| Protein Rubrerythrin, N-terminal domain [47242] (2 species) |
| Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries) |
| Domain d1jyba1: 1jyb A:2-147 [77206] Other proteins in same PDB: d1jyba2 |
PDB Entry: 1jyb (more details), 2.2 Å
SCOP Domain Sequences for d1jyba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyba1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv
Timeline for d1jyba1: