Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species) |
Species Escherichia coli [TaxId:562] [69771] (11 PDB entries) Uniprot P45568 |
Domain d1jvsa3: 1jvs A:126-274 [77189] Other proteins in same PDB: d1jvsa1, d1jvsa2, d1jvsa4, d1jvsa5, d1jvsb1, d1jvsb2, d1jvsb4 complexed with ndp, so4 |
PDB Entry: 1jvs (more details), 2.2 Å
SCOPe Domain Sequences for d1jvsa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jvsa3 d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} slvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltgs ggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasqm evlihpqsvihsmvryqdgsvlaqlgepd
Timeline for d1jvsa3:
View in 3D Domains from same chain: (mouse over for more information) d1jvsa1, d1jvsa2, d1jvsa4, d1jvsa5 |
View in 3D Domains from other chains: (mouse over for more information) d1jvsb1, d1jvsb2, d1jvsb3, d1jvsb4 |