Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (14 species) |
Species Helicobacter pylori, Nap [TaxId:210] [81743] (1 PDB entry) |
Domain d1ji4g_: 1ji4 G: [77123] complexed with fe, mpd, unx |
PDB Entry: 1ji4 (more details), 2.52 Å
SCOPe Domain Sequences for d1ji4g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ji4g_ a.25.1.1 (G:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]} mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv tvtyaddqlaklqksiwmlqahla
Timeline for d1ji4g_: