SCOP 1.75: Domain d1jgea2: 1jge A:1-181

Lineage for d1jgea2 (1jge A:1-181)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (8 PDB entries)
   Uniprot P03989 25-300

8. Domain d1jgea2: 1jge A:1-181 [77113]
   Other proteins in same PDB: d1jgea1, d1jgeb_

Details for d1jgea2

PDB Entry: 1jge, 2.1 Å

PDB Description: HLA-B*2705 bound to nona-peptide m9

PDB Compounds: (A:) hla class I histocompatibility antigen, b-27 b*2705 alpha chain

SCOP Domain Sequences for d1jgea2:

Sequence; same for both SEQRES and ATOM records:

>d1jgea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

Timeline for d1jgea2:

• d1jgea2 first appeared in SCOP 1.63
  
• d1jgea2 appears in SCOP 1.73
  
• d1jgea2 appears in SCOPe 2.01
  
• d1jgea2 appears in the current release, SCOPe 2.08