Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species) |
Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (6 PDB entries) |
Domain d1jgea2: 1jge A:1-181 [77113] Other proteins in same PDB: d1jgea1, d1jgeb_ |
PDB Entry: 1jge (more details), 2.1 Å
SCOP Domain Sequences for d1jgea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27} gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq r
Timeline for d1jgea2: