SCOP 1.73: Domain d1je8a_: 1je8 A:

Lineage for d1je8a_ (1je8 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
   contains additional, fourth helix in the C-terminal extension

6. Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species)

7. Species Escherichia coli [TaxId:562] [46902] (5 PDB entries)

8. Domain d1je8a_: 1je8 A: [77108]

Details for d1je8a_

PDB Entry: 1je8, 2.12 Å

PDB Description: Two-Component response regulator NarL/DNA Complex: DNA Bending Found in a High Affinity Site

PDB Compounds: (A:) nitrate/nitrite response regulator protein narl

SCOP Domain Sequences for d1je8a_:

Sequence; same for both SEQRES and ATOM records:

>d1je8a_ a.4.6.2 (A:) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]}
rdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwv
hqerif

Timeline for d1je8a_:

• d1je8a_ first appeared in SCOP 1.63
  
• d1je8a_ appears in SCOP 1.71
  
• d1je8a_ appears in SCOP 1.75
  
• d1je8a_ appears in the current release, SCOPe 2.08