Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) |
Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins) |
Protein UDP-N-acetylmuramate-alanine ligase MurC [82315] (2 species) |
Species Thermotoga maritima [TaxId:2336] [82316] (1 PDB entry) TM0231 |
Domain d1j6ua1: 1j6u A:1-88 [77094] Other proteins in same PDB: d1j6ua2, d1j6ua3, d1j6ua4 structural genomics CASP5 |
PDB Entry: 1j6u (more details), 2.3 Å
SCOPe Domain Sequences for d1j6ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j6ua1 c.5.1.1 (A:1-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} mkihfvgiggigmsavalhefsngndvygsnieetertaylrklgipifvphsadnwydp dlviktpavrddnpeivrarmervpien
Timeline for d1j6ua1: