Lineage for d1j6ua1 (1j6u A:1-88)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2458695Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2458696Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2458697Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 2458698Protein UDP-N-acetylmuramate-alanine ligase MurC [82315] (2 species)
  7. 2458708Species Thermotoga maritima [TaxId:2336] [82316] (1 PDB entry)
    TM0231
  8. 2458709Domain d1j6ua1: 1j6u A:1-88 [77094]
    Other proteins in same PDB: d1j6ua2, d1j6ua3, d1j6ua4
    structural genomics
    CASP5

Details for d1j6ua1

PDB Entry: 1j6u (more details), 2.3 Å

PDB Description: crystal structure of udp-n-acetylmuramate-alanine ligase murc (tm0231) from thermotoga maritima at 2.3 a resolution
PDB Compounds: (A:) UDP-N-acetylmuramate-alanine ligase MurC

SCOPe Domain Sequences for d1j6ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6ua1 c.5.1.1 (A:1-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]}
mkihfvgiggigmsavalhefsngndvygsnieetertaylrklgipifvphsadnwydp
dlviktpavrddnpeivrarmervpien

SCOPe Domain Coordinates for d1j6ua1:

Click to download the PDB-style file with coordinates for d1j6ua1.
(The format of our PDB-style files is described here.)

Timeline for d1j6ua1: