Lineage for d1j6pa1 (1j6p A:1-49,A:331-405)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819141Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2819142Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2819264Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins)
  6. 2819277Protein Hypothetical protein TM0936 [82225] (1 species)
  7. 2819278Species Thermotoga maritima [TaxId:2336] [82226] (3 PDB entries)
  8. 2819281Domain d1j6pa1: 1j6p A:1-49,A:331-405 [77089]
    Other proteins in same PDB: d1j6pa2, d1j6pa3
    structural genomics
    complexed with ni

Details for d1j6pa1

PDB Entry: 1j6p (more details), 1.9 Å

PDB Description: crystal structure of metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (tm0936) from thermotoga maritima at 1.9 a resolution
PDB Compounds: (A:) metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family

SCOPe Domain Sequences for d1j6pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6pa1 b.92.1.4 (A:1-49,A:331-405) Hypothetical protein TM0936 {Thermotoga maritima [TaxId: 2336]}
miignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpXkieegwnadl
vvidldlpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelarie
kelys

SCOPe Domain Coordinates for d1j6pa1:

Click to download the PDB-style file with coordinates for d1j6pa1.
(The format of our PDB-style files is described here.)

Timeline for d1j6pa1: