Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (5 proteins) automatically mapped to Pfam PF01026 |
Protein Hypothetical protein TM0667 [82268] (1 species) |
Species Thermotoga maritima [TaxId:2336] [82269] (1 PDB entry) |
Domain d1j6oa1: 1j6o A:0-255 [77088] Other proteins in same PDB: d1j6oa2 complexed with ipa |
PDB Entry: 1j6o (more details), 1.8 Å
SCOPe Domain Sequences for d1j6oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j6oa1 c.1.9.12 (A:0-255) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} mvdthahlhfhqfdddrnavissfeenniefvvnvgvnledskksldlsktsdrifcsvg vhphdakevpedfiehlekfakdekvvaigetgldffrnispaevqkrvfveqielagkl nlplvvhirdayseayeilrteslpekrgvihafssdyewakkfidlgfllgiggpvtyp knealrevvkrvgleyivletdcpflppqpfrgkrnepkylkyvvetisqvlgvpeakvd eattenarriflevke
Timeline for d1j6oa1: