Lineage for d1j3bb2 (1j3b B:2-211)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920701Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2920766Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species)
  7. 2920781Species Thermus thermophilus [TaxId:274] [82555] (4 PDB entries)
    Uniprot Q7SIC6
  8. 2920783Domain d1j3bb2: 1j3b B:2-211 [77074]
    Other proteins in same PDB: d1j3ba1, d1j3bb1
    complexed with ca, gol, po4

Details for d1j3bb2

PDB Entry: 1j3b (more details), 2 Å

PDB Description: Crystal structure of ATP-dependent phosphoenolpyruvate carboxykinase from Thermus thermophilus HB8
PDB Compounds: (B:) ATP-dependent phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d1j3bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3bb2 c.109.1.1 (B:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
spwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfqr
rlvlivgtkyageikksiftvmnylmpkrg

SCOPe Domain Coordinates for d1j3bb2:

Click to download the PDB-style file with coordinates for d1j3bb2.
(The format of our PDB-style files is described here.)

Timeline for d1j3bb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j3bb1