Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.30: C-terminal domain of the rap74 subunit of TFIIF [63480] (1 protein) automatically mapped to Pfam PF05793 |
Protein C-terminal domain of the rap74 subunit of TFIIF [63481] (1 species) peptide-recognition motif |
Species Human (Homo sapiens) [TaxId:9606] [63482] (4 PDB entries) |
Domain d1j2xa1: 1j2x A:451-517 [77066] Other proteins in same PDB: d1j2xa2 complexed with Fcp1 C-terminal peptide, chain B protein/RNA complex; complexed with so4, zn |
PDB Entry: 1j2x (more details), 2 Å
SCOPe Domain Sequences for d1j2xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2xa1 a.4.5.30 (A:451-517) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens) [TaxId: 9606]} dvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmindk mhfslke
Timeline for d1j2xa1: