SCOP 1.69: Domain d1j2xa_: 1j2x A:

Lineage for d1j2xa_ (1j2x A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.30: C-terminal domain of the rap74 subunit of TFIIF [63480] (1 protein)

6. Protein C-terminal domain of the rap74 subunit of TFIIF [63481] (1 species)
   peptide-recognition motif

7. Species Human (Homo sapiens) [TaxId:9606] [63482] (4 PDB entries)

8. Domain d1j2xa_: 1j2x A: [77066]
   complexed with Fcp1 C-terminal peptide, chain B

Details for d1j2xa_

PDB Entry: 1j2x, 2 Å

PDB Description: crystal structure of rap74 c-terminal domain complexed with fcp1 c- terminal peptide

SCOP Domain Sequences for d1j2xa_:

Sequence, based on SEQRES records:

>d1j2xa_ a.4.5.30 (A:) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens)}
gplgsgdvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnper
kmindkmhfslke

Sequence, based on observed residues (ATOM records):

>d1j2xa_ a.4.5.30 (A:) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens)}
gpldvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmi
ndkmhfslke

Timeline for d1j2xa_:

• d1j2xa_ first appeared in SCOP 1.63
  
• d1j2xa_ appears in SCOP 1.67
  
• d1j2xa_ appears in SCOP 1.71
  
• d1j2xa_ appears in the current release, SCOPe 2.08, called d1j2xa1