Lineage for d1j2xa_ (1j2x A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210555Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 210936Family a.4.5.30: C-terminal domain of the rap74 subunit of TFIIF [63480] (1 protein)
  6. 210937Protein C-terminal domain of the rap74 subunit of TFIIF [63481] (1 species)
    peptide-recognition motif
  7. 210938Species Human (Homo sapiens) [TaxId:9606] [63482] (3 PDB entries)
  8. 210940Domain d1j2xa_: 1j2x A: [77066]
    complexed with Fcp1 C-terminal peptide, chain B
    complexed with so4, zn

Details for d1j2xa_

PDB Entry: 1j2x (more details), 2 Å

PDB Description: crystal structure of rap74 c-terminal domain complexed with fcp1 c- terminal peptide

SCOP Domain Sequences for d1j2xa_:

Sequence, based on SEQRES records: (download)

>d1j2xa_ a.4.5.30 (A:) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens)}
gplgsgdvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnper
kmindkmhfslke

Sequence, based on observed residues (ATOM records): (download)

>d1j2xa_ a.4.5.30 (A:) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens)}
gpldvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmi
ndkmhfslke

SCOP Domain Coordinates for d1j2xa_:

Click to download the PDB-style file with coordinates for d1j2xa_.
(The format of our PDB-style files is described here.)

Timeline for d1j2xa_: