SCOPe 2.08: Domain d1j2xa1: 1j2x A:451-517

Lineage for d1j2xa1 (1j2x A:451-517)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.30: C-terminal domain of the rap74 subunit of TFIIF [63480] (1 protein)
   automatically mapped to Pfam PF05793

6. Protein C-terminal domain of the rap74 subunit of TFIIF [63481] (1 species)
   peptide-recognition motif

7. Species Human (Homo sapiens) [TaxId:9606] [63482] (4 PDB entries)

8. Domain d1j2xa1: 1j2x A:451-517 [77066]
   Other proteins in same PDB: d1j2xa2
   complexed with Fcp1 C-terminal peptide, chain B
   protein/RNA complex; complexed with so4, zn

Details for d1j2xa1

PDB Entry: 1j2x, 2 Å

PDB Description: crystal structure of rap74 c-terminal domain complexed with fcp1 c- terminal peptide

PDB Compounds: (A:) transcription initiation factor iif, alpha subunit

SCOPe Domain Sequences for d1j2xa1:

Sequence; same for both SEQRES and ATOM records:

>d1j2xa1 a.4.5.30 (A:451-517) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens) [TaxId: 9606]}
dvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmindk
mhfslke

Timeline for d1j2xa1:

• d1j2xa1 first appeared in SCOP 1.63, called d1j2xa_
  
• d1j2xa1 appears in SCOPe 2.07