Lineage for d1j2xa1 (1j2x A:451-517)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693886Family a.4.5.30: C-terminal domain of the rap74 subunit of TFIIF [63480] (1 protein)
    automatically mapped to Pfam PF05793
  6. 2693887Protein C-terminal domain of the rap74 subunit of TFIIF [63481] (1 species)
    peptide-recognition motif
  7. 2693888Species Human (Homo sapiens) [TaxId:9606] [63482] (4 PDB entries)
  8. 2693890Domain d1j2xa1: 1j2x A:451-517 [77066]
    Other proteins in same PDB: d1j2xa2
    complexed with Fcp1 C-terminal peptide, chain B
    protein/RNA complex; complexed with so4, zn

Details for d1j2xa1

PDB Entry: 1j2x (more details), 2 Å

PDB Description: crystal structure of rap74 c-terminal domain complexed with fcp1 c- terminal peptide
PDB Compounds: (A:) transcription initiation factor iif, alpha subunit

SCOPe Domain Sequences for d1j2xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2xa1 a.4.5.30 (A:451-517) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens) [TaxId: 9606]}
dvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmindk
mhfslke

SCOPe Domain Coordinates for d1j2xa1:

Click to download the PDB-style file with coordinates for d1j2xa1.
(The format of our PDB-style files is described here.)

Timeline for d1j2xa1: