SCOP 1.73: Domain d1j1xl_: 1j1x L:

Lineage for d1j1xl_ (1j1x L:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1j1xl_: 1j1x L: [77064]
   Other proteins in same PDB: d1j1xh_, d1j1xy_
   part of Fv HyHEL-10
   mutant

Details for d1j1xl_

PDB Entry: 1j1x, 1.8 Å

PDB Description: crystal structure of hyhel-10 fv mutant ls93a complexed with hen egg white lysozyme

PDB Compounds: (L:) lysozyme binding Ig kappa chain V23-J2 region

SCOP Domain Sequences for d1j1xl_:

Sequence; same for both SEQRES and ATOM records:

>d1j1xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnawpytfgggtkleik

Timeline for d1j1xl_:

• d1j1xl_ first appeared in SCOP 1.63
  
• d1j1xl_ appears in SCOP 1.71
  
• d1j1xl_ appears in SCOP 1.75
  
• d1j1xl_ appears in the current release, SCOPe 2.08