Lineage for d1j1xh_ (1j1x H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930322Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries)
  8. 930326Domain d1j1xh_: 1j1x H: [77063]
    Other proteins in same PDB: d1j1xl_, d1j1xy_
    part of Fv HyHEL-10
    mutant

Details for d1j1xh_

PDB Entry: 1j1x (more details), 1.8 Å

PDB Description: crystal structure of hyhel-10 fv mutant ls93a complexed with hen egg white lysozyme
PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d1j1xh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1xh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOPe Domain Coordinates for d1j1xh_:

Click to download the PDB-style file with coordinates for d1j1xh_.
(The format of our PDB-style files is described here.)

Timeline for d1j1xh_: