SCOP 1.71: Domain d1j1pl_: 1j1p L:

Lineage for d1j1pl_ (1j1p L:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)

8. Domain d1j1pl_: 1j1p L: [77061]
   Other proteins in same PDB: d1j1ph_, d1j1py_
   part of Fv HyHEL-10
   mutant

Details for d1j1pl_

PDB Entry: 1j1p, 1.8 Å

PDB Description: crystal structure of hyhel-10 fv mutant ls91a complexed with hen egg white lysozyme

SCOP Domain Sequences for d1j1pl_:

Sequence; same for both SEQRES and ATOM records:

>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqanswpytfgggtkleik

Timeline for d1j1pl_:

• d1j1pl_ first appeared in SCOP 1.63
  
• d1j1pl_ appears in SCOP 1.69
  
• d1j1pl_ appears in SCOP 1.73
  
• d1j1pl_ appears in the current release, SCOPe 2.08