| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
| Protein Neopullulanase, N-terminal domain [81960] (1 species) homologous to maltogenic amylase |
| Species Bacillus stearothermophilus [TaxId:1422] [81961] (4 PDB entries) |
| Domain d1j0kb1: 1j0k B:1-123 [77048] Other proteins in same PDB: d1j0ka2, d1j0ka3, d1j0kb2, d1j0kb3 |
PDB Entry: 1j0k (more details), 3.2 Å
SCOPe Domain Sequences for d1j0kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0kb1 b.1.18.2 (B:1-123) Neopullulanase, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
mrkeaiyhrpadnfayaydsetlhlrlrtkkddidrvellhgdpydwqngawqfqmmpmr
ktgsdelfdywfaevkppyrrlrygfvlysgeeklvytekgfyfevptddtayyfcfpfl
hrv
Timeline for d1j0kb1: