SCOP 1.69: Domain d1j0ib2: 1j0i B:506-588

Lineage for d1j0ib2 (1j0i B:506-588)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Neopullulanase [82175] (1 species)
   homologous to Maltogenic amylase

7. Species Bacillus stearothermophilus [TaxId:1422] [82176] (4 PDB entries)

8. Domain d1j0ib2: 1j0i B:506-588 [77037]
   Other proteins in same PDB: d1j0ia1, d1j0ia3, d1j0ib1, d1j0ib3

Details for d1j0ib2

PDB Entry: 1j0i, 2.4 Å

PDB Description: crystal structure of neopullulanase complex with panose

SCOP Domain Sequences for d1j0ib2:

Sequence; same for both SEQRES and ATOM records:

>d1j0ib2 b.71.1.1 (B:506-588) Neopullulanase {Bacillus stearothermophilus}
geisflhaddemnyliykktdgdetvlviinrsdqkadipipldargtwlvnlltgerfa
aeaetlctslppygfvlyaiehw

Timeline for d1j0ib2:

• d1j0ib2 first appeared in SCOP 1.63
  
• d1j0ib2 appears in SCOP 1.67
  
• d1j0ib2 appears in SCOP 1.71
  
• d1j0ib2 appears in the current release, SCOPe 2.08